GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

lymphotoxin-α   Click here for help

GtoPdb Ligand ID: 5064

Abbreviated name: TNFSF1
Synonyms: LTα | TNFβ
Immunopharmacology Ligand
Comment: LTA (TNFβ) is a pro-inflammarory cytokine mediating a large variety of inflammatory, immunostimulatory, and antiviral responses. LTA is required during embryonic development of lymphoid organs.
Species: Human
Is a component of
Peptide Sequence Click here for help
LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVV
FSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLS
PSTVFFGAFAL
Selected 3D Structures
PDB Id: 1tnr
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Partial O-linked glycosylation of threonine residue at position 7; N-linked glycosylation of asparagine at position 62