GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

TGFβ2   Click here for help

GtoPdb Ligand ID: 5061

Synonyms: cetermin | glioblastoma-derived T-cell suppressor factor (G-TSF) | polyergin | TGF-beta-2 | transforming growth factor beta-2
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Peptide Sequence Click here for help
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVS
QDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Selected 3D Structures
PDB Id: 1tfg
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
The active form of the peptide is a disulphide linked homodimer, with the bond between cysteine residues at position 77. Disulphide bonds between cysteine residues at positions 7 and 16, 15 and 78, 44 and 109, and 48 and 111