GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Abbreviated name: NT-4
Synonyms: neurotrophin-5 | NT-5
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
|
Peptide Sequence ![]() |
|
GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRG VDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA |
Selected 3D Structures | |||
|
Post-translational Modification | |
Disulphide bond formation between cysteine residues at positions 17 and 90, 161 and 119, and 78 and 121 |