GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

neuregulin-4   Click here for help

GtoPdb Ligand ID: 5031

Abbreviated name: NRG-4
Synonyms: neuregulin 4
Species: Human
Peptide Sequence Click here for help
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNL
Post-translational Modification
Predicted N-linked glycosylation of asparagine residue at position 39; predicted disulphide bond formation between cysteine residues at positions 9 and 23, 17 and 34, and 36 and 45