GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: interleukin-3 (IL-3) | multilineage-colony-stimulating factor (mCSF)
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IL-3 and GM-CSF share certain functional similarities.
Species: Human
|
Peptide Sequence ![]() |
|
|
APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKN LLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
|
| Post-translational Modification | |
| Predicted N-linked glycosylation of aspragine residues at positions 15 and 70; disulphide bond fromation between cysteine residues at positions 14 and 84 | |