GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-19   Click here for help

GtoPdb Ligand ID: 4984

Synonyms: interleukin-19 | melanoma differentiation-associated protein-like protein
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: IL-19 is an IL-10 related type II cytokine.
Species: Human
Peptide Sequence Click here for help
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKI
SSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
Selected 3D Structures
PDB Id: 1N1F
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 32 and 111; disulphide bomd formation between cysteine residues at positions 4 and 97, 51 and 103, and 52 and 105