From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

IL-1β   Click here for help

GtoPdb Ligand ID: 4974

Synonyms: catabolin | interleukin-1 beta
Immunopharmacology Ligand
Comment: IL-1β is an IL-1 family cytokine produced from the IL1B gene. It is produced by activated macrophages as a proprotein which is cleaved by cytosolic caspase 1 to the mature, active molecule.
Species: Human
Peptide Sequence Click here for help
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL
QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Selected 3D Structures
PDB Id: 2ila
Image of ligand 3D structure from RCSB PDB