GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: IFN alpha-10 | interferon alpha-10 | interferon alpha-6L | interferon alpha-C
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IFN-α10 is a type I IFN.
Species: Human
|
Peptide Sequence ![]() |
|
|
CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQS LLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQK RLRRKD |
|
| Post-translational Modification | |
| Predicted disulphide bond formation between cysteine residues at positions 1 and 99, and 29 and 139 | |