GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

GDNF   Click here for help

GtoPdb Ligand ID: 4940

Synonyms: astrocyte-derived trophic factor (ATF)
Comment: Biologically active GDNF is a disulphide-linked homodimer
Species: Human
Peptide Sequence Click here for help
SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYD
KILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Selected 3D Structures
PDB Id: 3FUB
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Biologically active peptide is a homodimer. Disulphide bonds between cysteine residues at positions 41 and 102, 68 and 131, and 72 and 133. Interchain diuslphide bond between cysteine residues at position 1 of each chain. Predicted N-linked glycosylation of asparagine residues at positions 49 and 85