GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

growth/differentiation factor-3   Click here for help

GtoPdb Ligand ID: 4938

Abbreviated name: GDF3
Synonyms: GDF-3
Compound class: Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
Peptide Sequence Click here for help
AAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCI
PTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG
Post-translational Modification
The active peptide is predicted to be either a homodimer or a heterodimer, which cannot be disulphide linked. Predicted N-linked glycosylation of asparagine residue at position 56; predicted disulphide bond formation between cysteine residues at positions 14 and 79, 43 and 111, and 47 and 113