GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

epiregulin   Click here for help

GtoPdb Ligand ID: 4918

Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Peptide Sequence Click here for help
VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL
Val-Ala-Gln-Val-Ser-Ile-Thr-Lys-Cys-Ser-Ser-Asp-Met-Asn-Gly-Tyr-Cys-Leu-His-Gly-Gln-Cys-Ile-Tyr-Leu-Val-Asp-Met-Ser-Gln-Asn-Tyr-Cys-Arg-Cys-Glu-Val-Gly-Tyr-Thr-Gly-Val-Arg-Cys-Glu-His-Phe-Phe-Leu
Selected 3D Structures
PDB Id: 1K37
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 9 and 22, 17 and 33, and 35 and 44