GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Abbreviated name: EPG
Synonyms: epithelial mitogen
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
|
Peptide Sequence ![]() |
|
|
AAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTS YAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRCLKLKSPYNVCSGERRPL |
|
| Post-translational Modification | |
| Predicted N-linked glycosylation of asparagine residues at positions 15 and 19; predicted disulphide bonf formation between cysteine resdiues at positions 38 and 51, 46 and 62, and 64 and 73 | |