GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ephrin-B1   Click here for help

GtoPdb Ligand ID: 4913

Abbreviated name: EFNB1
Synonyms: EFL-3 | ELK ligand | EPH-related receptor tyrosine kinase ligand 2 | LERK-2
Comment: From the ephrin B family. A single TM protein
Species: Human
Peptide Sequence Click here for help
LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQE
IRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADN
TVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRK
RHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Post-translational Modification
Serine residue at position 260 is phosphoserine; tyrosine residues at positions 286 and 290 are phosphotyrosine; predicted N-linked glycosylation of asparagine residue at position 112; predicted disulphide bond formation between cysteine residues at positions 17 and 74, and 62 and 126