GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
|
Peptide Sequence ![]() |
|
|
AANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNA TNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH |
|
| Post-translational Modification | |
| The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 102 of each chain. Predicted N-linked glycososylation of asparagine residues at positions 11, 29 and 79. Predicted disulphide bond formation between cysteine residues at positions 37 and 103, 66 and 135, and 70 and 137 | |