GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
|
Peptide Sequence ![]() |
|
|
NAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEP ISILYLDKGVVTYKFKYEGMAVSECGCR |
|
| Post-translational Modification | |
| The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 72 of each chain. Predicted disulphide bond formation between cysteine residues at positions 7 and 73, 36 and 105, and 40 and 107 | |