GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

protein C light chain   Click here for help

GtoPdb Ligand ID: 4480

Compound class: Endogenous peptide in human, mouse or rat
Species: Rat
Is a component of
protein C
Peptide Sequence Click here for help
ANSFLEEVRAGSLERECMEEICDFEEAQEIFQNVEDTLAFWIKYFDGDQCSTPPLDHQCDSPCCGHGTCIDGLGGFSCSC
DKGWEGRFCQQEMGFQDCRVKNGGCYHYCLEETRGRRCRCAPGYELADDHMHCRPTVNFPCGKLWKRTDKKRKNF
Post-translational Modification
Rat protein C consists of a light chain and a heavy chain held together by a disulfide bond between cysteine residues at positions 141 of the light chain and 122 of the heavy chain