GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Compound class:
Endogenous peptide in human, mouse or rat
Species: Rat
|
Is a component of |
relaxin |
Peptide Sequence ![]() |
|
RVSEEWMDQVIQVCGRGYARAWIEVCGASVGRLAL | |
Arg-Val-Ser-Glu-Glu-Trp-Met-Asp-Gln-Val-Ile-Gln-Val-Cys-Gly-Arg-Gly-Tyr-Ala-Arg-Ala-Trp-Ile-Glu-Val-Cys-Gly-Ala-Ser-Val-Gly-Arg-Leu-Ala-Leu |
Post-translational Modification | |
Fully active rat relaxin is a heterodimer of the B chain and the A chain linked by two disulfide bonds, the first between B chain (residue 14) and A chain (residue 151), and the second between B chain (residue 26) and A chain (residue 164). |