GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

relaxin B chain   Click here for help

GtoPdb Ligand ID: 4437

Compound class: Endogenous peptide in human, mouse or rat
Species: Rat
Is a component of
relaxin
Peptide Sequence Click here for help
RVSEEWMDQVIQVCGRGYARAWIEVCGASVGRLAL
Arg-Val-Ser-Glu-Glu-Trp-Met-Asp-Gln-Val-Ile-Gln-Val-Cys-Gly-Arg-Gly-Tyr-Ala-Arg-Ala-Trp-Ile-Glu-Val-Cys-Gly-Ala-Ser-Val-Gly-Arg-Leu-Ala-Leu
Post-translational Modification
Fully active rat relaxin is a heterodimer of the B chain and the A chain linked by two disulfide bonds, the first between B chain (residue 14) and A chain (residue 151), and the second between B chain (residue 26) and A chain (residue 164).