GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

R-spondin-2   Click here for help

GtoPdb Ligand ID: 3698

Synonyms: hRspo2 | Roof plate-specific spondin-2
Species: Human
Click here for help
Peptide Sequence Click here for help
QGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENC
DSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPV
KDTILCPTIAESRRCKMTMRHCPGGKRTPKAKEKRNKKKKRKLIERAQEQHSVFLATDRANQ
Post-translational Modification
Asparagine residue at position 139 is N-linked glycosylated; disulfide bonds between cysteine residues at positions 124 and 166; 135 and 142; 175 and 182