GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

agouti-related protein   Click here for help

GtoPdb Ligand ID: 3611

Abbreviated name: AGRP
Synonyms: agouti-related peptide
Compound class: Endogenous peptide in human, mouse or rat
Species: Mouse
Peptide Sequence Click here for help
VQMGVAPLKGIRRPDQALFPEFPGLSLNGLKKTTADRAEEVLLQKAEALAEVLDPQNRESRSPRRCVRLHESCLGQQVPC
CDPCATCYCRFFNAFCYCRKLGTATNLCSRT
Val-Gln-Met-Gly-Val-Ala-Pro-Leu-Lys-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Phe-Pro-Glu-Phe-Pro-Gly-Leu-Ser-Leu-Asn-Gly-Leu-Lys-Lys-Thr-Thr-Ala-Asp-Arg-Ala-Glu-Glu-Val-Leu-Leu-Gln-Lys-Ala-Glu-Ala-Leu-Ala-Glu-Val-Leu-Asp-Pro-Gln-Asn-Arg-Glu-Ser-Arg-Ser-Pro-Arg-Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Thr-Asn-Leu-Cys-Ser-Arg-Thr
Post-translational Modification
Disulfide bonds are formed between cysteine residues 66 and 81, 73 and 87, 80 and 98, 84 and 108, 89 and 96.