From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

adrenomedullin 2/intermedin   Click here for help

GtoPdb Ligand ID: 3590

Species: Mouse
Peptide Sequence Click here for help
PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSY
Pro-His-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Val-Arg-Pro-Ala-Gly-Arg-Arg-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2
Post-translational Modification
The cysteine residues at positions 10 and 15 form a disulphide bridge and the C-terminal tyrosine is amidated.