GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
| 
                                                                Synonyms: big gastrin (rat)
                                 Compound class: 
                                                            Endogenous peptide in human, mouse or rat
                                 
                                    Species: Rat
                                 | 
| Peptide Sequence  | |
| XLGPQGPQHFIADLSKKQRPPMEEEEEAYGWMDF | |
| pGlu-Leu-Gly-Pro-Gln-Gly-Pro-Gln-His-Phe-Ile-Ala-Asp-Leu-Ser-Lys-Lys-Gln-Arg-Pro-Pro-Met-Glu-Glu-Glu-Glu-Glu-Ala-Tys-Gly-Trp-Met-Asp-Phe-NH2 | |
| Post-translational Modification | |
| The N-terminal glutamic acid is cyclated into pyroglutamic acid (represented by pGlu and X), the tyrosine residue at position 29 is sulfated (represented by Tys) and the C-terminal phenylalanine is amidated. | |