GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: big gastrin (mouse)
Compound class:
Endogenous peptide in human, mouse or rat
Species: Mouse
|
Peptide Sequence ![]() |
|
XLGLQGPQHFIADLSKKERPRMEEEEEAYGWMDF | |
pGlu-Leu-Gly-Leu-Gln-Gly-Pro-Gln-His-Phe-Ile-Ala-Asp-Leu-Ser-Lys-Lys-Glu-Arg-Pro-Arg-Met-Glu-Glu-Glu-Glu-Glu-Ala-Tys-Gly-Trp-Met-Asp-Phe-NH2 |
Post-translational Modification | |
The N-terminal glutamic acid cyclizes into pyroglutamic acid (represented by pGlu and X); the tyrosine residue at position 29 is sulfated (Tys) and the C-terminal phenylalanine is amidated. |