GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

gastrin-34   Click here for help

GtoPdb Ligand ID: 3563

Synonyms: big gastrin (mouse)
Species: Mouse
Peptide Sequence Click here for help
XLGLQGPQHFIADLSKKERPRMEEEEEAYGWMDF
pGlu-Leu-Gly-Leu-Gln-Gly-Pro-Gln-His-Phe-Ile-Ala-Asp-Leu-Ser-Lys-Lys-Glu-Arg-Pro-Arg-Met-Glu-Glu-Glu-Glu-Glu-Ala-Tys-Gly-Trp-Met-Asp-Phe-NH2
Post-translational Modification
The N-terminal glutamic acid cyclizes into pyroglutamic acid (represented by pGlu and X); the tyrosine residue at position 29 is sulfated (Tys) and the C-terminal phenylalanine is amidated.