GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CCK-33   Click here for help

GtoPdb Ligand ID: 3551

Compound class: Endogenous peptide in human, mouse or rat
Species: Rat
Peptide Sequence Click here for help
KAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDF
Lys-Ala-Pro-Ser-Gly-Arg-Met-Ser-Val-Leu-Lys-Asn-Leu-Gln-Gly-Leu-Asp-Pro-Ser-His-Arg-Ile-Ser-Asp-Arg-Asp-Tys-Met-Gly-Trp-Met-Asp-Phe-NH2
Post-translational Modification
The C-terminal phenylalanine is amidated and the tyrosine residue at position 27 is sulfated, as indicated by Tys which represents Tyr(SO3H).