From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

ATX-II   Click here for help

GtoPdb Ligand ID: 2614

Synonyms: anemonia viridis toxin 2 | Sea anemone toxin II (Anemonia sulcata) | toxin ATX-II
Compound class: Peptide
Comment: From Anemonia sulcata (Mediterranean snakelocks sea anemone)
Click here for help
Peptide Sequence Click here for help
GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ
Gly-Val-Pro-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Ile-Ile-Trp-Leu-Ala-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Lys-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 4 and 44, 6 and 34, and 27 and 45