GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

PACAP-38   Click here for help

GtoPdb Ligand ID: 2258

Synonyms: pituitary adenylate cyclase activating polypeptide-38
Comment: Sequences of human, mouse, rat and sheep PACAP-38 are identical.

PACAP-38 has been proposed as a novel target for the teament of migraine [7]. In response, Alder BioPharmaceuticals have developed an anti-PACAP-38 monoclonal antibody (ALD1910) that has progressed to clinical evaluation (NCT04197349).
Species: Human, Mouse, Rat
Click here for help
Peptide Sequence Click here for help
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
Post-translational Modification
C-terminal residue is lysine amide