GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

PTH   Click here for help

GtoPdb Ligand ID: 1785

Synonyms: Natpar® | Natpara® | rhPTH[1-84]
Approved drug
PTH is an approved drug (FDA (2015), EMA (2017))
Comment: In its recombinant form, human parathyroid hormone was approved for clinical use in 2015, under the name Natpara.
The amino acid sequence provided here is the mature peptide, with the signal (MIPAKDMAKVMIVMLAICFLTKSDG) and propeptide (KSVKKR) domains removed.
Species: Human
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: pth

Peptide Sequence Click here for help
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTK
AKSQ
Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Leu-Ala-Pro-Arg-Asp-Ala-Gly-Ser-Gln-Arg-Pro-Arg-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-His-Glu-Lys-Ser-Leu-Gly-Glu-Ala-Asp-Lys-Ala-Asp-Val-Asn-Val-Leu-Thr-Lys-Ala-Lys-Ser-Gln
Post-translational Modification
None.