GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

large neurotensin   Click here for help

GtoPdb Ligand ID: 1577

Synonyms: large NT
Comment: Large neurotensin is a differentially cleaved long peptide derived from pro-neurotensin/neuromedin. This from of the peptide is produced mainly in the adrenals glands [1].
Species: Human
Click here for help
Peptide Sequence Click here for help
DSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTI
YQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKR