From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

FAM150A   Click here for help

GtoPdb Ligand ID: 14203

Synonyms: AUG-β | augmentor-β | augmentor-beta
Compound class: Endogenous peptide in human, mouse or rat
Comment: FAM150A (AUG-β) is an endogenous leukocyte receptor tyrosine kinase (LTK) activating ligand [1-2].
Species: Human
Peptide Sequence Click here for help
MRPLKPGAPLPALFLLALALSPHGAHGRPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT