GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

interleukin 18 binding protein   Click here for help

GtoPdb Ligand ID: 13868

Immunopharmacology Ligand
Comment: Interleukin 18 binding protein (IL18BP) binds to and inhibits the activity of circulating pro-inflammatory IL-18 at its receptor [3].
Synthetic IL18BP mimetics offer potential anti-inflammatory action for the treatment of inflammation-mediated (and autoimmune) diseases [1-2].
Species: Human
Peptide Sequence Click here for help
MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNG
TLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQ
RHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG