From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

annexin A3   Click here for help

GtoPdb Ligand ID: 13777

Synonyms: annexin III | calcimedin 35-alpha | inositol 1,2-cyclic phosphate 2-phosphohydrolase (EC 3.1.4.43) | lipocortin III | placental anticoagulant protein III
Compound class: Endogenous peptide in human, mouse or rat
Comment: Annexin A3 (ANXA3) is one member of a family of intracellular calcium-dependent phospholipid-binding proteins (13 genes in humans). It regulates cellular growth and signal transduction pathways via inhibition of phopholipase A2. This activity modulates the conversion of inositol 1,2-cyclic phosphate to inositol 1-phosphate.
Pathogenic effects of ANXA3 have been reported in the development of cancers [2,4], in particular triple-negative breast cancer (TNBC) [5]. Pharmacological modulation of ANXA3 is therefore of interest for the development of TNBC therapeutics.
Species: Human
Peptide Sequence Click here for help
MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKDDLKGDLSGHF
EHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLA
DGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLL
LAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICG
GDD