GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

FGF-19   Click here for help

GtoPdb Ligand ID: 11545

Synonyms: fibroblast growth factor 19
Comment: FGF-19 is a fibroblast growth factor that mediates a wide range of mitogenic and cell survival activities. It is one of the endogenous ligands for fibroblast growth factor receptor 4 (FGFR4) [2]. FGF-19 is a major player in the gut-liver axis that maintains bile acid homeostasis, its expression is induced in the liver under cholestatic and cirrhotic conditions, and it is implicated in the development of hepatocellular carcinoma (HCC).
Species: Human
Click here for help
Peptide Sequence Click here for help
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLL
EIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFL
PLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Post-translational Modification
Amino acids 1-24 form the signal peptide of the precursor protein.