From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

tissue factor pathway inhibitor   Click here for help

GtoPdb Ligand ID: 11181

Comment: TFPI is a serine protease inhibitor that regulates the tissue factor (TF)-dependent blood coagulation pathway (extrinsic pathway). It inhibits activated factor X (Xa) and VIIa-TF proteases in an autoregulatory loop. Some isoforms are tethered to the cell membrane by expression of a glycosylphosphatidylinositol (GPI) anchor, others isoforms are secreted [1-2]. Inhibition of the TFPI restores hemostasis, which is a mechanism being exploited for therapeutic benefit in inherited bleeding disorders.
Species: Human
Peptide Sequence Click here for help
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCE
EFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLG
NMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIG
KCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Post-translational Modification
1-28 is the signal peptide.