GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

Noggin   Click here for help

GtoPdb Ligand ID: 10975

Comment: Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite. Noggin is an inhibitor of several bone morphogenetic proteins (BMPs): it inhibits at least BMP2, BMP4, BMP5, BMP6, BMP7, BMP13, and BMP14.
Species: Human
Peptide Sequence Click here for help
QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQL
LRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVP
EGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Selected 3D Structures
PDB Id: 1M4U
Image of ligand 3D structure from RCSB PDB