From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

delta like canonical Notch ligand 3   Click here for help

GtoPdb Ligand ID: 10560

Abbreviated name: DLL3
Synonyms: SCDO1
Comment: DLL3 is is an inhibitory NOTCH pathway ligand. The mature protein is 592 amino acids long and contains DSL and transmembrane domains, and EGF repeats that are characteristic of NOTCH family ligands. DLL3 can be detected in the cytoplasm of a few normal adult cell types (neurons, pancreatic islet cells, pituitary cells). In contrast, its expression is highly upregulated to the surface of malignant cells of neuroendocrine origin, including small cell lung cancer (SCLC) [5-6], melanoma, glioblastoma multiforme, small cell bladder cancer, metastatic castration-resistant prostate cancer, and neuroendocrine lung tumours, and is detected on cancer stem cells. Its favourable expression profile has enabled DLL3-targeted therapeutic development for these cancer indications [3-4]. To date, DLL3-targeted therapies include an antibody-drug conjugate (rovalpituzumab tesirine; max phase 3, development terminated), a bispecific T cell engager (tarlatamab, formerly AMG757; max phase 3) and a chimeric antigen receptor T cell therapy (AMG119; max phase 1), all of which were first evaluated in advanced SCLC.
Species: Human
Peptide Sequence Click here for help
MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALG
AALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWAR
DIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCL
EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGP
CFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRAC
ANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP
PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHALPDALNNLRTQEGSGDGPSSS
VDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRAGQRQHLLFPYPSSILSVK