Click here for a description of the charts and data table
Please tell us if you are using this feature and what you think!
| ChEMBL ligand: CHEMBL316034 |
|---|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
There should be some charts here, you may need to enable JavaScript!
|
| DB | Assay description | Assay Type | Standard value | Standard parameter | Original value | Original units | Original parameter | Reference |
|---|---|---|---|---|---|---|---|---|
| Alpha-ketoglutarate-dependent dioxygenase FTO in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2331065] [UniProtKB: Q9C0B1] | ||||||||
| ChEMBL | Inhibition of human hexahistidine-tagged full-length FTO expressed in Escherichia coli BL21 (DE3) using 3-methylthymidine as substrate assessed as inhibition of 3-methylthymidine conversion to thymidine after 1 hr by liquid chromatographic analysis | B | 5.08 | pIC50 | 8300 | nM | IC50 | J Med Chem (2013) 56: 3680-3688 [PMID:23547775] |
| ChEMBL | Competitive inhibition of FTO (unknown origin) using 3mT nucleoside as substrate by UPLC analysis | B | 5.08 | pIC50 | 8300 | nM | IC50 | J Med Chem (2025) 68: 2742-2763 [PMID:39818964] |
| Aspartyl/asparaginyl beta-hydroxylase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4680030] [UniProtKB: Q12797] | ||||||||
| ChEMBL | Inhibition of N-His6-tagged human AspH (315-755) expressed in Escherichia coli BL21 (DE3) using 1 uM hFX-CP as substrate mixture with high 200 uM 2OG, 100 uM L-ascorbic acid and 2 uM FAS incubated for 35 mins by MS analysis | B | 7 | pIC50 | 100 | nM | IC50 | Bioorg Med Chem (2020) 28: 115675-115675 [PMID:33069066] |
| ChEMBL | Inhibition of N-His6-tagged human AspH (315-755) expressed in Escherichia coli BL21 (DE3) using 1 uM hFX-CP as substrate mixture with 3 uM 2OG, 100 uM L-ascorbic acid and high 20 uM FAS incubated for 35 mins by MS analysis | B | 7.52 | pIC50 | 30 | nM | IC50 | Bioorg Med Chem (2020) 28: 115675-115675 [PMID:33069066] |
| ChEMBL | Inhibition of N-His6-tagged human AspH (315-755) expressed in Escherichia coli BL21 (DE3) using 1 uM hFX-CP as substrate mixture with 3 uM 2OG, 100 uM L-ascorbic acid and 2 uM FAS incubated for 35 mins by MS analysis | B | 7.7 | pIC50 | 20 | nM | IC50 | Bioorg Med Chem (2020) 28: 115675-115675 [PMID:33069066] |
| ChEMBL | Inhibition of N-His6-tagged human AspH (315-755) expressed in Escherichia coli BL21 (DE3) using high 10 uM hFX-CP as substrate mixture with 10 uM 2OG, 100 uM L-ascorbic acid and 2 uM FAS incubated for 35 mins by MS analysis | B | 7.7 | pIC50 | 20 | nM | IC50 | Bioorg Med Chem (2020) 28: 115675-115675 [PMID:33069066] |
| Beta-lactamase in Aeromonas hydrophila (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3885662] [UniProtKB: Q44079] | ||||||||
| ChEMBL | Inhibition of Aeromonas hydrophila beta lactamase CphA at pH 8.0 | B | 4.46 | pKi | 35000 | nM | Ki | Antimicrob Agents Chemother (2007) 51: 2136-2142 [PMID:17307979] |
| ChEMBL | Inhibition of Aeromonas hydrophila beta lactamase CphA at pH 7.0 | B | 4.77 | pKi | 17000 | nM | Ki | Antimicrob Agents Chemother (2007) 51: 2136-2142 [PMID:17307979] |
| ChEMBL | Inhibition of Aeromonas hydrophila beta lactamase CphA by competitive inhibition assay | B | 5.35 | pKi | 4500 | nM | Ki | Antimicrob Agents Chemother (2007) 51: 2136-2142 [PMID:17307979] |
| lysine demethylase 8/Bifunctional peptidase and arginyl-hydroxylase JMJD5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4523396] [GtoPdb: 2687] [UniProtKB: Q8N371] | ||||||||
| ChEMBL | Inhibition of N-terminal his6-tagged human recombinant JMJD5 (183 to 416 residues) using RPS6 as substrate by SPE-MS analysis | B | 6.3 | pIC50 | 500 | nM | IC50 | J Med Chem (2023) 66: 10849-10865 [PMID:37527664] |
| egl-9 family hypoxia inducible factor 1/Egl nine homolog 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5697] [GtoPdb: 2833] [UniProtKB: Q9GZT9] | ||||||||
| ChEMBL | Binding affinity to human PHD2 catalytic domain (181 to 426) Mn2 expressed in Escherichia coli by NMR spectroscopic analysis | B | 6.38 | pKd | 420 | nM | Kd | J Med Chem (2013) 56: 547-555 [PMID:23234607] |
| ChEMBL | Inhibition of human recombinant PHD2 | B | 5.15 | pKi | 7000 | nM | Ki | J Med Chem (2008) 51: 7053-7056 [PMID:18942826] |
| ChEMBL | Inhibition of recombinant human PHD2 using 2OG as substrate and Fe2 as co-factor assessed as hydroxylation incubated for 15 mins in presence of L-ascorbate by LC-MS analysis | B | 5.15 | pIC50 | 7000 | nM | IC50 | Bioorg Med Chem (2019) 27: 2405-2412 [PMID:30737136] |
| ChEMBL | Inhibition of human recombinant PHD2 expressed in Sf9 cells by time-resolved fluorescence assay | B | 5.21 | pIC50 | 6100 | nM | IC50 | J Med Chem (2010) 53: 5629-5638 [PMID:20684604] |
| ChEMBL | Inhibition of PHD2 (unknown origin) | B | 5.22 | pIC50 | 6000 | nM | IC50 | J Med Chem (2021) 64: 16974-17003 [PMID:34792334] |
| ChEMBL | Inhibition of human PHD2 catalytic domain (181 to 426) Mn2 expressed in Escherichia coli by NMR spectroscopic analysis | B | 5.7 | pIC50 | 2000 | nM | IC50 | J Med Chem (2013) 56: 547-555 [PMID:23234607] |
| Gamma-butyrobetaine dioxygenase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2163175] [UniProtKB: O75936] | ||||||||
| ChEMBL | Inhibition of BBOX1 (unknown origin) | B | 4.09 | pIC50 | 82000 | nM | IC50 | J Med Chem (2021) 64: 16974-17003 [PMID:34792334] |
| Hypoxia-inducible factor 1-alpha inhibitor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5909] [UniProtKB: Q9NWT6] | ||||||||
| ChEMBL | Inhibition of N-terminal His6-tagged full-length FIH (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using SMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN peptide/100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay | B | 5.07 | pIC50 | 8600 | nM | IC50 | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| ChEMBL | Inhibition of FIH (unknown origin) | B | 5.96 | pIC50 | 1100 | nM | IC50 | J Med Chem (2021) 64: 16974-17003 [PMID:34792334] |
| lysine demethylase 2A/Lysine-specific demethylase 2A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1938210] [GtoPdb: 2671] [UniProtKB: Q9Y2K7] | ||||||||
| ChEMBL | Inhibition of KDM2A (unknown origin) expressed in Escherichia coli using Biotin H3 (28 to 48 residues) Me2 KDM2A Cognate Ligande/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 15 mins followed by substrate addition measured after 30 mins by alphascreen assay | B | 4.89 | pIC50 | 12800 | nM | IC50 | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| ChEMBL | Inhibition of KDM2A (unknown origin) | B | 5.39 | pIC50 | 4100 | nM | IC50 | J Med Chem (2013) 56: 7222-7231 [PMID:23964788] |
| ChEMBL | Inhibition of KDM2A (unknown origin) | B | 5.39 | pIC50 | 4100 | nM | IC50 | J Med Chem (2021) 64: 16974-17003 [PMID:34792334] |
| ChEMBL | Inhibition of KDM2A (unknown origin) | B | 5.4 | pIC50 | 3981.07 | nM | IC50 | Medchemcomm (2014) 5: 1879-1886 [PMID:26682034] |
| lysine demethylase 3A/Lysine-specific demethylase 3A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1938209] [GtoPdb: 2673] [UniProtKB: Q9Y4C1] | ||||||||
| ChEMBL | Inhibition of KDM3A (unknown origin) | B | 5.1 | pIC50 | 7943.28 | nM | IC50 | Medchemcomm (2014) 5: 1879-1886 [PMID:26682034] |
| ChEMBL | Inhibition of KDM3A (unknown origin) expressed in Escherichia coli using H3 (1 to 21 residues) K9Me2-GGK-Biotin KDM3A Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 20 mins by alphascreen assay | B | 5.48 | pIC50 | 3300 | nM | IC50 | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| lysine demethylase 4A/Lysine-specific demethylase 4A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5896] [GtoPdb: 2675] [UniProtKB: O75164] | ||||||||
| ChEMBL | Inhibition of recombinant His-tagged JMJD2A expressed in Escherichia coli Rosetta 2 (DE3) pLysS cells by formaldehyde dehydrogenase-coupled assay | B | 5.38 | pIC50 | 4200 | nM | IC50 | J Med Chem (2010) 53: 5629-5638 [PMID:20684604] |
| ChEMBL | Inhibition of KDM4A (unknown origin) using H3K9me3 peptide and 2-oxoglutarate as substrate after 1 hr by FDH-coupled assay | B | 5.38 | pIC50 | 4200 | nM | IC50 | J Med Chem (2013) 56: 7222-7231 [PMID:23964788] |
| GtoPdb | FDH (formaldehyde dehydrogenase) coupled assay. | - | 6.15 | pIC50 | 700 | nM | IC50 | J Med Chem (2008) 51: 7053-6 [PMID:18942826] |
| ChEMBL | Inhibition of human JMJD2A by FDH coupled assay | B | 6.15 | pIC50 | 700 | nM | IC50 | J Med Chem (2008) 51: 7053-7056 [PMID:18942826] |
| lysine demethylase 4C/Lysine-specific demethylase 4C in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6175] [GtoPdb: 2677] [UniProtKB: Q9H3R0] | ||||||||
| ChEMBL | Inhibition of KDM4C catalytic core-mediated demethylation of ARK(Me)3STGGK after 30 mins by FDH-coupled assay | B | 4.89 | pKi | 13000 | nM | Ki | Bioorg Med Chem Lett (2012) 22: 5811-5813 [PMID:22917519] |
| ChEMBL | Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using ARK(Me3)STGGK peptide/alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis | B | 8.66 | pKi | 2.2 | nM | Ki | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| ChEMBL | Inhibition of KDM4C catalytic core-mediated demethylation of ARK(Me)3STGGK after 30 mins by FDH-coupled assay | B | 4.41 | pIC50 | 39000 | nM | IC50 | Bioorg Med Chem Lett (2012) 22: 5811-5813 [PMID:22917519] |
| ChEMBL | Inhibition of recombinant His-tagged JMJD2C expressed in Escherichia coli Rosetta 2 (DE3) pLysS cells by formaldehyde dehydrogenase-coupled assay | B | 5.03 | pIC50 | 9400 | nM | IC50 | J Med Chem (2010) 53: 5629-5638 [PMID:20684604] |
| ChEMBL | Inhibition of KDM4C (unknown origin) using H3K9me3 peptide and 2-oxoglutarate as substrate after 1 hr by FDH-coupled assay | B | 5.09 | pIC50 | 8200 | nM | IC50 | J Med Chem (2013) 56: 7222-7231 [PMID:23964788] |
| ChEMBL | Inhibition of KDM4C (unknown origin) | B | 5.6 | pIC50 | 2511.89 | nM | IC50 | Medchemcomm (2014) 5: 1879-1886 [PMID:26682034] |
| ChEMBL | Inhibition of KDM4C | B | 5.62 | pIC50 | 2400 | nM | IC50 | Bioorg Med Chem Lett (2012) 22: 5811-5813 [PMID:22917519] |
| ChEMBL | Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using 250 uM ARK(Me3)STGGK peptide/50 uM alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis | B | 5.72 | pIC50 | 1900 | nM | IC50 | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| ChEMBL | Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using 50 uM ARK(Me3)STGGK peptide/50 uM alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis | B | 5.82 | pIC50 | 1500 | nM | IC50 | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| ChEMBL | Inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using biotinylated peptide/ 2 uM alpha-ketoglutarate as substrate/cofactor preincubated for 15 mins followed by substrate addition measured after 15 mins by alphascreen assay | B | 5.92 | pIC50 | 1200 | nM | IC50 | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| ChEMBL | Inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using ARTKQTARK(Me3)STGGKA peptide/100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay | B | 6.21 | pIC50 | 620 | nM | IC50 | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| ChEMBL | Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using 50 uM ARK(Me3)STGGK peptide/5 uM alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis | B | 6.28 | pIC50 | 530 | nM | IC50 | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| ChEMBL | Inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using biotinylated histone H3 (1 to 21 residues) lysine 9 trimethylated peptide/2 uM alpha-ketoglutarate as substrate/cofactor measured after 45 mins by TR-FRET assay | B | 6.73 | pIC50 | 188 | nM | IC50 | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| ChEMBL | Inhibition of KDM4C (unknown origin) | B | 7.72 | pIC50 | 19 | nM | IC50 | Eur J Med Chem (2020) 208: 112760-112760 [PMID:32883639] |
| lysine demethylase 4D/Lysine-specific demethylase 4D in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6138] [GtoPdb: 2678] [UniProtKB: Q6B0I6] | ||||||||
| ChEMBL | Inhibition of KDM4D (unknown origin) expressed in Escherichia coli using H3 (1 to 21 residues) K9Me3-GGK-Biotin KDM4 Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 20 mins by alphascreen assay | B | 5.62 | pIC50 | 2400 | nM | IC50 | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| lysine demethylase 4E/Lysine-specific demethylase 4E in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1293226] [GtoPdb: 2679] [UniProtKB: B2RXH2] | ||||||||
| ChEMBL | Inhibition of KDM4E (unknown origin) | B | 5.2 | pIC50 | 6309.57 | nM | IC50 | Medchemcomm (2014) 5: 1879-1886 [PMID:26682034] |
| ChEMBL | Inhibition of KDM4E (unknown origin) | B | 5.33 | pIC50 | 4700 | nM | IC50 | J Med Chem (2021) 64: 16974-17003 [PMID:34792334] |
| ChEMBL | Inhibition of KDM4E (unknown origin ) incubated for 20 mins by Alphascreen assay | B | 5.52 | pIC50 | 3000 | nM | IC50 | Eur J Med Chem (2021) 226: 113855-113855 [PMID:34555614] |
| GtoPdb | FDH (formaldehyde dehydrogenase) coupled assay. | - | 5.85 | pIC50 | 1400 | nM | IC50 | J Med Chem (2008) 51: 7053-6 [PMID:18942826] |
| ChEMBL | Inhibition of his6-tagged human recombinant KDM4E using K9me3 as substrate by SPE-MS analysis | B | 6.52 | pIC50 | 300 | nM | IC50 | J Med Chem (2023) 66: 10849-10865 [PMID:37527664] |
| lysine demethylase 5A/Lysine-specific demethylase 5A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2424504] [GtoPdb: 2680] [UniProtKB: P29375] | ||||||||
| ChEMBL | Inhibition of KDM5A (unknown origin) using H3K4me3 peptide and 2-oxoglutarate as substrate after 1 hr by FDH-coupled assay | B | 4 | pIC50 | 100000 | nM | IC50 | J Med Chem (2013) 56: 7222-7231 [PMID:23964788] |
| ChEMBL | Inhibition of N-terminal his6-tagged human KDM5A (1 to 797 residues) expressed in sf9 insect cells incubated for 20 mins by Alphascreen assay | B | 5.31 | pIC50 | 4920 | nM | IC50 | Eur J Med Chem (2021) 226: 113855-113855 [PMID:34555614] |
| ChEMBL | Inhibition of KDM5A (1 to 797 residues) (unknown origin) expressed in insect sf21 cells using ARTK(Me3)QTARKSTGGKAPRK peptide/ 100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay | B | 6.12 | pIC50 | 760 | nM | IC50 | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| lysine demethylase 5B/Lysine-specific demethylase 5B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3774295] [GtoPdb: 2681] [UniProtKB: Q9UGL1] | ||||||||
| ChEMBL | Inhibition of recombinant KDM5B catalytic domain (1 to 769 residues) (unknown origin) | B | 5.52 | pIC50 | 3000 | nM | IC50 | Eur J Med Chem (2019) 161: 131-140 [PMID:30343192] |
| ChEMBL | Inhibition of recombinant KDM5B catalytic core (1 to 729 residues) (unknown origin) expressed in baculovirus infected insect cells by FDH coupled assay | B | 5.52 | pIC50 | 3000 | nM | IC50 | Eur J Med Chem (2020) 208: 112760-112760 [PMID:32883639] |
| ChEMBL | Inhibition of KDM5B (unknown origin) | B | 5.52 | pIC50 | 3000 | nM | IC50 | Eur J Med Chem (2023) 251: 115250-115250 [PMID:36931124] |
| ChEMBL | Inhibition of N-terminal His6/GST-tagged KDM5B catalytic core (1 to 769 residues) (unknown origin) expressed in baculovirus infected High Five cells by FDH-coupled assay | B | 5.52 | pIC50 | 3000 | nM | IC50 | Eur J Med Chem (2024) 272: 116494-116494 [PMID:38749268] |
| ChEMBL | Inhibition of KDM5B (unknown origin) expressed in Escherichia coli using H3 (1 to 21 residues) K4Me3-GGK-Biotin KDM5B Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 20 mins by alphascreen assay | B | 5.57 | pIC50 | 2700 | nM | IC50 | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| lysine demethylase 5C/Lysine-specific demethylase 5C in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2163176] [GtoPdb: 2682] [UniProtKB: P41229] | ||||||||
| ChEMBL | Inhibition of KDM5C (unknown origin) | B | 6.3 | pIC50 | 501.19 | nM | IC50 | Medchemcomm (2014) 5: 1879-1886 [PMID:26682034] |
| lysine demethylase 6B/Lysine-specific demethylase 6B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1938211] [GtoPdb: 2685] [UniProtKB: O15054] | ||||||||
| ChEMBL | Inhibition of KDM6B (unknown origin) expressed in Escherichia coli using H3 (21 to 44 residues) K27Me3-GGK-Biotin JMJD3 Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 5 mins by alphascreen assay | B | 4.35 | pIC50 | 44600 | nM | IC50 | J Med Chem (2016) 59: 1580-1598 [PMID:26699912] |
| ChEMBL | Inhibition of KDM6B (unknown origin) | B | 4.5 | pIC50 | 31622.78 | nM | IC50 | Medchemcomm (2014) 5: 1879-1886 [PMID:26682034] |
| ChEMBL | Inhibition of KDM6B (unknown origin ) incubated for 20 mins by Alphascreen assay | B | 5.7 | pIC50 | 2000 | nM | IC50 | Eur J Med Chem (2021) 226: 113855-113855 [PMID:34555614] |
| lysine demethylase 7A/Lysine-specific demethylase 7A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2163177] [GtoPdb: 2686] [UniProtKB: Q6ZMT4] | ||||||||
| ChEMBL | Inhibition of KDM7A (unknown origin) using K27me2 peptide as substrate by MALDI assay | B | 4.82 | pIC50 | 15000 | nM | IC50 | J Med Chem (2013) 56: 7222-7231 [PMID:23964788] |
| Methylcytosine dioxygenase TET1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4523402] [UniProtKB: Q8NFU7] | ||||||||
| ChEMBL | Inhibition of N-terminal 3xFlag-tagged human TET1 catalytic domain (E1418 to V2136 residues) expressed in Sf9 cells using 5-methylcytosine as substrate preincubated for 10 mins followed by DNA-cofactor addition and measured after 30 mins by Alphascreen assay | B | 5.77 | pIC50 | 1698.24 | nM | IC50 | J Med Chem (2024) 67: 4525-4540 [PMID:38294854] |
| Methylcytosine dioxygenase TET2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4523344] [UniProtKB: Q6N021] | ||||||||
| ChEMBL | Inhibition of His10-FLAG tagged human TET2 catalytic domain (Q969 to I2002 residues) expressed in Sf9 cells using 5-methylcytosine as substrate preincubated for 10 mins followed by DNA-cofactor addition and measured after 10 mins by Alphascreen assay | B | 5.29 | pIC50 | 5128.61 | nM | IC50 | J Med Chem (2024) 67: 4525-4540 [PMID:38294854] |
| Methylcytosine dioxygenase TET3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4879414] [UniProtKB: O43151] | ||||||||
| ChEMBL | Inhibition of human TET3 catalytic domain (E824 to I1795 residues) expressed in mammalian cells using 5-methylcytosine as substrate preincubated for 10 mins followed by DNA-cofactor addition and measured after 10 mins by Alphascreen assay | B | 6.11 | pIC50 | 776.25 | nM | IC50 | J Med Chem (2024) 67: 4525-4540 [PMID:38294854] |
| Prolyl 4-hydroxylase in Paramecium bursaria Chlorella virus 1 (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4523368] [UniProtKB: Q84406] | ||||||||
| ChEMBL | Inhibition of N-terminal His6-tagged recombinant Paramecium bursaria chlorella virus 1 CPH expressed in Escherichia coli Rosetta 2 (DE3) cells pre-incubated for 5 mins before 2OG as substrate and Fe2 as co-factor addition in presence of L-ascorbate and measured after 5 mins MALDI TOF MS analysis | B | 5.48 | pKi | 3280 | nM | Ki | Bioorg Med Chem (2019) 27: 2405-2412 [PMID:30737136] |
| ChEMBL | Inhibition of N-terminal His6-tagged recombinant Paramecium bursaria chlorella virus 1 CPH expressed in Escherichia coli Rosetta 2 (DE3) cells pre-incubated for 5 mins before 2OG as substrate and Fe2 as co-factor addition in presence of L-ascorbate and measured after 5 mins MALDI TOF MS analysis | B | 5.28 | pIC50 | 5300 | nM | IC50 | Bioorg Med Chem (2019) 27: 2405-2412 [PMID:30737136] |
| egl-9 family hypoxia inducible factor 2/Prolyl hydroxylase EGLN2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3028] [GtoPdb: 2832] [UniProtKB: Q96KS0] | ||||||||
| ChEMBL | Inhibition of human recombinant HIF PHD1 | B | 5.15 | pKi | 7000 | nM | Ki | J Med Chem (2008) 51: 7053-7056 [PMID:18942826] |
| ChEMBL | Inhibition of human recombinant PHD1 expressed in Sf9 cells by time-resolved fluorescence assay | B | 5.82 | pIC50 | 1500 | nM | IC50 | J Med Chem (2010) 53: 5629-5638 [PMID:20684604] |
| egl-9 family hypoxia inducible factor 3/Prolyl hydroxylase EGLN3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5705] [GtoPdb: 2834] [UniProtKB: Q9H6Z9] | ||||||||
| ChEMBL | Inhibition of human recombinant HIF PHD3 | B | 5.15 | pKi | 7000 | nM | Ki | J Med Chem (2008) 51: 7053-7056 [PMID:18942826] |
| RNA demethylase ALKBH5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3621037] [UniProtKB: Q6P6C2] | ||||||||
| ChEMBL | Inhibition of ALKBH5 (unknown origin) | B | 5.03 | pIC50 | 9430 | nM | IC50 | J Med Chem (2021) 64: 16974-17003 [PMID:34792334] |
ChEMBL data shown on this page come from version 37:
Zdrazil B, Felix E, Hunter F, Manners EJ, Blackshaw J, Corbett S, de Veij M, Ioannidis H, Lopez DM, Mosquera JF, Magarinos MP, Bosc N, Arcila R, Kizilören T, Gaulton A, Bento AP, Adasme MF, Monecke P, Landrum GA, Leach AR. (2024). The ChEMBL Database in 2023: a drug discovery platform spanning multiple bioactivity data types and time periods. Nucleic Acids Res., 52(D1). DOI: 10.1093/nar/gkad1004. [EPMCID:10767899] [PMID:37933841]
Davies M, Nowotka M, Papadatos G, Dedman N, Gaulton A, Atkinson F, Bellis L, Overington JP. (2015) 'ChEMBL web services: streamlining access to drug discovery data and utilities.' Nucleic Acids Res., 43(W1). DOI: 10.1093/nar/gkv352. [EPMCID:25883136]