GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

isunakinra   Click here for help

GtoPdb Ligand ID: 9704

Synonyms: EBI-005
Immunopharmacology Ligand
Compound class: Peptide
Comment: Isunakinra (EBI-005) is a fusion protein containing domains from IL-1β and IL-1 receptor antagonist (IL-1Ra or anakinra) [3]. It potently blocks IL-1R1 signalling, with higher affinity than anakinra. It was developed as a topical therapy for inflammatory diseases of the ocular surface.
Click here for help
Peptide Sequence Click here for help
APVRSLNCRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQ
LESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWFLCTAMEADQPVSLTNMPDEGVMVTKFYMQFVSS