GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

STM 434   Click here for help

GtoPdb Ligand ID: 8991

Compound class: Peptide
Comment: STM 434 is an investigational fusion protein containing the extracellular domain of the activin receptor type 2B (ACVR2B, a.k.a. ActRIIB) fused to the Fc domain of human IgG1. This is one of the inventions claimed in patent US8501678 B2 [1]. It is not entirely clear which construct is STM 434, but it is likely to be either vActRIIB-IgG1Fc E28W (E10W) mature polypeptide (which has SEQ ID: 62) or vActRIIB-IgG1Fc E28Y (E10Y) mature polypeptide (SEQ ID: 64).
Peptide Sequence Click here for help
SGRGEAETR(W/Y)CIYYNANWELERTNQSGLERCEGEQDKRLHCYASW(A/R)NSSGTIELVKKGCWLDDFNCYDRQEC
VATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTGGGGSVDKTHTCPPCPAPELLGGPSVFLFPPKPKDT
LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA
PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL
TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Chemical Modification
Amino acids 1-116 is the sequence of the variant extracellular domain of the human ActRIIB
Amino acids 117-121 (GGGGS) is the linker
Amino acids 122-349 is the sequence of a partial hinge region and Fc region of human IgG1