human GIP(3-42)NH2   Click here for help

GtoPdb Ligand ID: 8970

Compound class: Peptide
Comment: GIP(3-42)NH2 is a truncated form of gastric inhibitory polypeptide (GIP) formed through degradation by dipeptidyl peptidase IV (DPP IV). At high concentration GIP(3-42)NH2 acts as a low potency antagonist of the GIP receptor, weakly antagonizing cAMP accumulation and insulin output in vitro, but no physiological antagonism is observed in vivo [1].
Click here for help
Peptide Sequence Click here for help
EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-NH2
Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln