GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CXCL122 (dimer)   Click here for help

GtoPdb Ligand ID: 8535

Compound class: Peptide
Comment: A constitutive dimer of human CXCL12α carrying two cysteine substitutions (L36C and A65C) promoting the formation of trans-peptide disulphide bonds which lock the dimer structure [2].
Click here for help
Peptide Sequence Click here for help
KPVSLSYRCPCRFFESHVARANVKHCKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKCLNK
Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Cys-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Cys-Leu-Asn-Lys