GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CXCL12H25R (monomer)   Click here for help

GtoPdb Ligand ID: 8534

Compound class: Peptide
Comment: Sequence of human CXCL12α with His25 replaced by Arg, which will only act as a peptide monomer [1].
Click here for help
Peptide Sequence Click here for help
KPVSLSYRCPCRFFESHVARANVKRLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-Arg-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys