GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-γ1b (human recombinant)   Click here for help

GtoPdb Ligand ID: 8341

Synonyms: Actimmune®. | IFNγ2a
Approved drug
IFN-γ1b (human recombinant) is an approved drug (FDA (1999))
Compound class: Peptide
Comment: This is a recombinant analogue of human interferon gamma (IFN-γ) produced in E.coli and is therefore not glycosylated.
Peptide Sequence Click here for help
MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNV
KFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFR