GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-β1b (recombinant human)   Click here for help

GtoPdb Ligand ID: 8340

Synonyms: Betaferon® | Betaseron® | Extavia® | IFNb1b
Approved drug Immunopharmacology Ligand
IFN-β1b (recombinant human) is an approved drug (FDA (1993), EMA (1995))
Compound class: Peptide
Comment: Compared to the sequence of endogenous IFN-β, IFN-β1b has a Ser to Cys substitution at position 17, but does not retain the glycosylation site at Asn80. It also lacks the initiating Met. This recombinant peptide is produced in E.coli.
Peptide Sequence Click here for help
MSYNLLGFLQRSSNFNCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRDSSSTGWNE
TIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLT
GYLRN
Chemical Modification
A disulphide bridge forms between Cys31 and Cys141.