GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

conkunitzin-S1 toxin   Click here for help

GtoPdb Ligand ID: 7758

Synonyms: conk-S1 | Kunitz-type conkunitzin-S1
Compound class: Peptide
Comment: From Conus striatus (striated cone).
Click here for help
Peptide Sequence Click here for help
KDRPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCLYT
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 7 and 57, and 22 and 53. C-terminal threonine residue is threonine amide.