GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

pegfilgrastim   Click here for help

GtoPdb Ligand ID: 6969

Synonyms: Neulasta®
Approved drug
pegfilgrastim is an approved drug (FDA and EMA (2002))
Compound class: Peptide
Comment: This is a PEGylated version of recombinant human G-CSF. Pegylation increases circulating half-life. In addition to pegfilgrastim, lipegfilgrastim (Lonquex®) is a glyco-PEGylated long-acting G-CSF, that is an alternative to pegfilgrastim [1].

Biosimilars:
NameTrade nameCompanyApprovalsIndications
pegfilgrastim-jmbd; MYL-1401HFulphilaMylan/Biocon2018 FDA & EMAAs per reference agent [2]
 PelgrazAccord2018 EMAAs per reference agent
 PelmegMundipharma (developed by Cinfa Biotech)2018 EMAAs per reference agent
 pegfilgrastim MundipharmaMundipharma 2019 EMAAs per reference agent
pegfilgrastim-cbqv; CHS-1701UdenycaERA Consulting; Coherus BioSciences2018 FDA & EMAAs per reference agent
USV pegfilgrastimGrasustekJuta Pharma2019 EMAAs per reference agent
pegfilgrastim-bmez; LA-EP2006ZiextenzoSandoz2018 EMA, 2019 FDAAs per reference agent
pegfilgrastim-apgf; PF-06881894NyvepriaPfizer2020 FDAAs per reference agent
pegfilgrastim-fpgk; MSB11455StimufendFresenius Kabi2022 FDA & EMAAs per reference agent
pegfilgrastim-pbbkFylnetraAmneal Pharmaceuticals2022 FDAAs per reference agent
pegfilgrastim biosimilar; BP14DyrupegCuraTeQ Biologics2025 EMAAs per reference agent
pegfilgrastim biosimilarVivlipegBiocon/Biosimilar Collaborations Ireland2025 EMAAs per reference agent
pegfilgrastim biosimilar; BP14DyrupegCuraTeQ Biologics/Aurobindo Pharma2025 EMA & UK MHRAAs per reference agent
Peptide Sequence Click here for help
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEEL
VLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMA
PALQPTQGAMPAFASAFQRR AGGVLVASHLQSFLEVSYRVLRHLAQP