GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

filgrastim   Click here for help

GtoPdb Ligand ID: 6968

Synonyms: Filcad® | Imumax ® | R-METHUG-CSF
Approved drug Immunopharmacology Ligand
filgrastim is an approved drug (FDA (1991))
Compound class: Peptide
Comment: This is a recombinant version of human G-CSF. The peptide is produced in E. coli and is non-glycosylated, whereas the naturally occurring peptide has an O-linked carbohydrate chain attached to Thr133. The carbohydrate chain protects the native peptide from degradation by human neutrophil elastase [1]. Therefore, filgrastim is more quickly degraded and loses biological activity more rapidly in comparison to native G-CSF.

Biosimilar drugs: The potential for utilising filgrastim biosimilar agents in neutropenia management is discussed in [2].

NameTrade name CompanyApprovalsIndications
filgrastim-sndzZarxio®SandozUS FDA 2015, EU EMA 2025As per reference agent
filgrastim-aafiNivestym® PfizerUS FDA 2018As per reference agent
filgrastim-ayowReleuko® Amneal PharmaceuticalsUS FDA 2022As per reference agent
filgrastim-txid; TX01Nypozi®Tanvex BioPharmaCanada CDA-AMC 2022, US FDA 2024 As per reference agent
filgrastim biosimilar Zefylti® CuraTeQ Biologics/Aurobindo PharmaEU EMA 2025 As per reference agent
filgrastim-laha Filkri® Accord BioPharmaUS FDA 2026 As per reference agent

In the EU 7 filgrastim biosimilars received marketing authorisation between 2008 and 2014 (Ratiograstim®, Tevagrastim®, Filgrastim Hexal®, Zarzio®, Nivestim®, Grastofil® and Accofil®, in order of approval), although some of these have since been withdrawn from the market.
Peptide Sequence Click here for help
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEEL
VLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMA
PALQPTQGAMPAFASAFQRR AGGVLVASHLQSFLEVSYRVLRHLAQP