GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

[125I]GHRH (human)   Click here for help

GtoPdb Ligand ID: 3783

Synonyms: [125I]-GHRH | [125I]-growth hormone releasing hormone | [125I]-Tyr10-hGHRH(1-44)NH2 | [125I]GHRH(1-44)NH2
 Ligand is labelled  Ligand is radioactive
Compound class: Peptide
Comment: Radiolabelled form of human GHRH
Click here for help
Peptide Sequence Click here for help
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-[125I]Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
Chemical Modification
Tyrosine residue 10 is radiolabelled with 125I