GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

heteropodatoxin-2   Click here for help

GtoPdb Ligand ID: 2581

Synonyms: κ-sparatoxin-Hv1b | κ-SPRTX-Hv1b | HpTX2 | HpTx2 | Toxin KJ6
Compound class: Peptide
Comment: From Heteropoda venatoria (Brown huntsman spider)
Click here for help
Peptide Sequence Click here for help
DDCGKLFSGCDTNADCCEGYVCRLWCKLDW
Asp-Asp-Cys-Gly-Lys-Leu-Phe-Ser-Gly-Cys-Asp-Thr-Asn-Ala-Asp-Cys-Cys-Glu-Gly-Tyr-Val-Cys-Arg-Leu-Trp-Cys-Lys-Leu-Asp-Trp-NH2
Post-translational Modification
C-terminal tryptophan residue undergoes amidation; disulphide bond formation between cysteine residues at positions 3 and 17, 10 and 22, and 16 and 26.