GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

jingzhaotoxin-III   Click here for help

GtoPdb Ligand ID: 2574

Synonyms: β-theraphotoxin-Cj1a | β-TRTX-Cj1a | Jingzhaotoxin-3 | JZTX-III
Compound class: Peptide
Comment: From Chilobrachys jingzhao (Chinese earth tiger tarantula)
Click here for help
Peptide Sequence Click here for help
DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP
Asp-Gly-Glu-Cys-Gly-Gly-Phe-Trp-Trp-Lys-Cys-Gly-Arg-Gly-Lys-Pro-Pro-Cys-Cys-Lys-Gly-Tyr-Ala-Cys-Ser-Lys-Thr-Trp-Gly-Trp-Cys-Ala-Val-Glu-Ala-Pro
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 4 and 19, 11 and 24, and 18 and 31.