GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

[125I]BgK (W5Y / Y26F)   Click here for help

GtoPdb Ligand ID: 2565

 Ligand is labelled  Ligand is radioactive
Compound class: Peptide
Comment: Radiolabelled analogue of BgK
Click here for help
Peptide Sequence Click here for help
VCRDYFKETACRHAKSLGNCRTSQKFRANCAKTCELC
Val-Cys-Arg-Asp-Tyr-Phe-Lys-Glu-Thr-Ala-Cys-Arg-His-Ala-Lys-Ser-Leu-Gly-Asn-Cys-Arg-Thr-Ser-Gln-Lys-Phe-Arg-Ala-Asn-Cys-Ala-Lys-Thr-Cys-Glu-Leu-Cys
Chemical Modification
Tryptophan residue at position 5 of the natural sequence and tyrosine at position 26 are replaced by tyrosine and phenylalanine respectively