GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ShK(L5)   Click here for help

GtoPdb Ligand ID: 2557

Synonyms: ShK-170
Compound class: Peptide
Comment: A synthetic analogue of ShK toxin
Click here for help
Peptide Sequence Click here for help
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC
pTyr-Arg-Ser-Cys-Ile-Asp-Thr-Ile-Pro-Lys-Ser-Arg-Cys-Thr-Ala-Phe-Gln-Cys-Lys-His-Ser-Met-Lys-Tyr-Arg-Leu-Ser-Phe-Cys-Arg-Lys-Thr-Cys-Gly-Thr-Cys
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 3 and 35, 12 and 28, and 17 and 32.
Chemical Modification
Residue 1 is L-phosphotyrosine